Lineage for d3m6gb1 (3m6g B:4-146)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2884130Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (15 PDB entries)
  8. 2884140Domain d3m6gb1: 3m6g B:4-146 [213137]
    automated match to d1lotb1
    complexed with atp, ca, lo3, mg

Details for d3m6gb1

PDB Entry: 3m6g (more details), 2 Å

PDB Description: crystal structure of actin in complex with lobophorolide
PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d3m6gb1:

Sequence, based on SEQRES records: (download)

>d3m6gb1 c.55.1.1 (B:4-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d3m6gb1 c.55.1.1 (B:4-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ettalvcdngsglvkagfagddapravfpsivgrprdsyvgdeaqskrgiltlkypiehg
iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv
aiqavlslyasg

SCOPe Domain Coordinates for d3m6gb1:

Click to download the PDB-style file with coordinates for d3m6gb1.
(The format of our PDB-style files is described here.)

Timeline for d3m6gb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3m6gb2