Lineage for d3m0eb_ (3m0e B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2127737Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2128070Protein automated matches [190766] (4 species)
    not a true protein
  7. 2128071Species Aquifex aeolicus [TaxId:63363] [226012] (1 PDB entry)
  8. 2128073Domain d3m0eb_: 3m0e B: [213112]
    automated match to d1ny6c_
    complexed with atp, mg; mutant

Details for d3m0eb_

PDB Entry: 3m0e (more details), 2.63 Å

PDB Description: crystal structure of the atp-bound state of walker b mutant of ntrc1 atpase domain
PDB Compounds: (B:) transcriptional regulator (NtrC family)

SCOPe Domain Sequences for d3m0eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m0eb_ c.37.1.20 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva
siprdifeaelfgyekgaftgavsskegffeladggtlfldaigelsleaqakllrvies
gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi
iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr
gelsclv

SCOPe Domain Coordinates for d3m0eb_:

Click to download the PDB-style file with coordinates for d3m0eb_.
(The format of our PDB-style files is described here.)

Timeline for d3m0eb_: