Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein automated matches [190766] (4 species) not a true protein |
Species Aquifex aeolicus [TaxId:63363] [226012] (1 PDB entry) |
Domain d3m0ea_: 3m0e A: [213111] automated match to d1ny6c_ complexed with atp, mg; mutant |
PDB Entry: 3m0e (more details), 2.63 Å
SCOPe Domain Sequences for d3m0ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m0ea_ c.37.1.20 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]} eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva siprdifeaelfgyekgaftgavsskegffeladggtlfldaigelsleaqakllrvies gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr gelsclv
Timeline for d3m0ea_: