Lineage for d3kslb_ (3ksl B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) 
Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins) Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) 
Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
Uniprot Q02293 22-418 P53610
Domain d3kslb_: 3ksl B: [212534]
Other proteins in same PDB: d3ksla_
automated match to d1d8db_
complexed with mg, szh, zn
Details for d3kslb_
PDB Entry: 3ksl (more details), 2.05 Å
PDB Description: structure of fpt bound to datfp-dh-gpp
PDB Compounds: (B:) Protein farnesyltransferase subunit betaSCOPe Domain Sequences for d3kslb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kslb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfh
ylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggf
gggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevd
vrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalv
ilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgd
palsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsga
mlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf
SCOPe Domain Coordinates for d3kslb_:
Click to download the PDB-style file with coordinates for d3kslb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3kslb_:
- d3kslb_ first appeared in SCOPe 2.03
- d3kslb_ appears in SCOPe 2.07
View in 3D
