Lineage for d3ksla_ (3ksl A:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) 
Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins) Protein Protein farnesyltransferase alpha-subunit [48441] (2 species) 
Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
Uniprot Q04631 55-369
Domain d3ksla_: 3ksl A: [212533]
Other proteins in same PDB: d3kslb_
automated match to d1o5ma_
complexed with mg, szh, zn
Details for d3ksla_
PDB Entry: 3ksl (more details), 2.05 Å
PDB Description: structure of fpt bound to datfp-dh-gpp
PDB Compounds: (A:) Farnesyltransferase, CAAX box, alphaSCOPe Domain Sequences for d3ksla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ksla_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gflsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrders
erafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrr
vlvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrn
nsvwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsryp
nllnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirk
eywryigrslqskhs
SCOPe Domain Coordinates for d3ksla_:
Click to download the PDB-style file with coordinates for d3ksla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ksla_:
- d3ksla_ first appeared in SCOPe 2.03
- d3ksla_ appears in SCOPe 2.06
View in 3D
