Lineage for d1d8db_ (1d8d B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) 
Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins) Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) 
Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
Uniprot Q02293 22-418 P53610
Domain d1d8db_: 1d8d B: [18866]
Other proteins in same PDB: d1d8da_
complex with K-ras4b peptide substrate
complexed with act, fii, zn
Details for d1d8db_
PDB Entry: 1d8d (more details), 2 Å
PDB Description: co-crystal structure of rat protein farnesyltransferase complexed with a k-ras4b peptide substrate and fpp analog at 2.0a resolution
PDB Compounds: (B:) farnesyltransferase (beta subunit)SCOPe Domain Sequences for d1d8db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8db_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
dggfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvg
gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
aalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
gsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf
SCOPe Domain Coordinates for d1d8db_:
Click to download the PDB-style file with coordinates for d1d8db_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d8db_:
- d1d8db_ first appeared (with stable ids) in SCOP 1.55
- d1d8db_ appears in SCOPe 2.07
View in 3D
