SCOPe 2.08: Domain d3k92d2: 3k92 D:191-424

Lineage for d3k92d2 (3k92 D:191-424)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [196388] (13 PDB entries)

8. Domain d3k92d2: 3k92 D:191-424 [212232]
   Other proteins in same PDB: d3k92a1, d3k92b1, d3k92c1, d3k92d1, d3k92e1, d3k92f1
   automated match to d1v9la1
   complexed with peg; mutant

Details for d3k92d2

PDB Entry: 3k92, 2.3 Å

PDB Description: Crystal structure of a E93K mutant of the majour Bacillus subtilis glutamate dehydrogenase RocG

PDB Compounds: (D:) nad-specific glutamate dehydrogenase

SCOPe Domain Sequences for d3k92d2:

Sequence, based on SEQRES records:

>d3k92d2 c.2.1.0 (D:191-424) automated matches {Bacillus subtilis [TaxId: 1423]}
ggsqgretataqgvticieeavkkkgiklqnariiiqgfgnagsflakfmhdagakvigi
sdangglynpdgldipylldkrdsfgmvtnlftdvitneellekdcdilvpaaisnqita
knahniqasivverangpttidatkilnergvllvpdilasaggvtvsyfewvqnnqgyy
wseeevaeklrsvmvssfetiyqtaathkvdmrlaaymtgirksaeasrfrgwv

Sequence, based on observed residues (ATOM records):

>d3k92d2 c.2.1.0 (D:191-424) automated matches {Bacillus subtilis [TaxId: 1423]}
ggsqgretataqgvticieeavkkkgiklqnariiiqgfgnagsflakfmhdagakvigi
sdangglynpdgldipylldkrdmvtnlftdvitneellekdcdilvpaaisnqitakna
hniqasivverangpttidatkilnergvllvpdilasaggvtvsyfewvqnnqgyywse
eevaeklrsvmvssfetiyqtaathkvdmrlaaymtgirksaeasrfrgwv

Timeline for d3k92d2:

• d3k92d2 first appeared in SCOPe 2.03
  
• d3k92d2 appears in SCOPe 2.07