SCOPe 2.07: Domain d3k92c1: 3k92 C:16-190

Lineage for d3k92c1 (3k92 C:16-190)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (31 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225904] (2 PDB entries)

8. Domain d3k92c1: 3k92 C:16-190 [212229]
   Other proteins in same PDB: d3k92a2, d3k92b2, d3k92c2, d3k92d2, d3k92e2, d3k92f2
   automated match to d1v9la2
   complexed with peg; mutant

Details for d3k92c1

PDB Entry: 3k92, 2.3 Å

PDB Description: Crystal structure of a E93K mutant of the majour Bacillus subtilis glutamate dehydrogenase RocG

PDB Compounds: (C:) nad-specific glutamate dehydrogenase

SCOPe Domain Sequences for d3k92c1:

Sequence; same for both SEQRES and ATOM records:

>d3k92c1 c.58.1.0 (C:16-190) automated matches {Bacillus subtilis [TaxId: 1423]}
nlflstqtiikealrklgypgdmyelmkepqrmltvripvkmdngsvkvftgyrsqhnda
vgptkggvrfhpevneekvkalsiwmtlkcgianlpygggkggiicdprtmsfgelerls
rgyvraisqivgptkdipapdvytnsqimawmmdeysrlrefdspgfitgkplvl

Timeline for d3k92c1:

• d3k92c1 first appeared in SCOPe 2.03
  
• d3k92c1 appears in SCOPe 2.06