PDB entry 3k92

View 3k92 on RCSB PDB site
Description: Crystal structure of a E93K mutant of the majour Bacillus subtilis glutamate dehydrogenase RocG
Class: oxidoreductase
Keywords: RocG, glutamate dehydrogenase, NAD, Oxidoreductase
Deposited on 2009-10-15, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad-specific glutamate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39633 (Start-423)
      • engineered mutation (92)
      • see remark 999 (323)
    Domains in SCOPe 2.07: d3k92a1, d3k92a2
  • Chain 'B':
    Compound: nad-specific glutamate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39633 (Start-423)
      • engineered mutation (92)
      • see remark 999 (323)
    Domains in SCOPe 2.07: d3k92b1, d3k92b2
  • Chain 'C':
    Compound: nad-specific glutamate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39633 (Start-423)
      • engineered mutation (92)
      • see remark 999 (323)
    Domains in SCOPe 2.07: d3k92c1, d3k92c2
  • Chain 'D':
    Compound: nad-specific glutamate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39633 (Start-423)
      • engineered mutation (92)
      • see remark 999 (323)
    Domains in SCOPe 2.07: d3k92d1, d3k92d2
  • Chain 'E':
    Compound: nad-specific glutamate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39633 (Start-423)
      • engineered mutation (92)
      • see remark 999 (323)
    Domains in SCOPe 2.07: d3k92e1, d3k92e2
  • Chain 'F':
    Compound: nad-specific glutamate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39633 (Start-423)
      • engineered mutation (92)
      • see remark 999 (323)
    Domains in SCOPe 2.07: d3k92f1, d3k92f2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k92A (A:)
    msakqvskdeekealnlflstqtiikealrklgypgdmyelmkepqrmltvripvkmdng
    svkvftgyrsqhndavgptkggvrfhpevneekvkalsiwmtlkcgianlpygggkggii
    cdprtmsfgelerlsrgyvraisqivgptkdipapdvytnsqimawmmdeysrlrefdsp
    gfitgkplvlggsqgretataqgvticieeavkkkgiklqnariiiqgfgnagsflakfm
    hdagakvigisdangglynpdgldipylldkrdsfgmvtnlftdvitneellekdcdilv
    paaisnqitaknahniqasivverangpttidatkilnergvllvpdilasaggvtvsyf
    ewvqnnqgyywseeevaeklrsvmvssfetiyqtaathkvdmrlaaymtgirksaeasrf
    rgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k92A (A:)
    skdeekealnlflstqtiikealrklgypgdmyelmkepqrmltvripvkmdngsvkvft
    gyrsqhndavgptkggvrfhpevneekvkalsiwmtlkcgianlpygggkggiicdprtm
    sfgelerlsrgyvraisqivgptkdipapdvytnsqimawmmdeysrlrefdspgfitgk
    plvlggsqgretataqgvticieeavkkkgiklqnariiiqgfgnagsflakfmhdagak
    vigisdangglynpdgldipylldkrdsfgmvtnlftdvitneellekdcdilvpaaisn
    qitaknahniqasivverangpttidatkilnergvllvpdilasaggvtvsyfewvqnn
    qgyywseeevaeklrsvmvssfetiyqtaathkvdmrlaaymtgirksaeasrfrgwv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k92B (B:)
    msakqvskdeekealnlflstqtiikealrklgypgdmyelmkepqrmltvripvkmdng
    svkvftgyrsqhndavgptkggvrfhpevneekvkalsiwmtlkcgianlpygggkggii
    cdprtmsfgelerlsrgyvraisqivgptkdipapdvytnsqimawmmdeysrlrefdsp
    gfitgkplvlggsqgretataqgvticieeavkkkgiklqnariiiqgfgnagsflakfm
    hdagakvigisdangglynpdgldipylldkrdsfgmvtnlftdvitneellekdcdilv
    paaisnqitaknahniqasivverangpttidatkilnergvllvpdilasaggvtvsyf
    ewvqnnqgyywseeevaeklrsvmvssfetiyqtaathkvdmrlaaymtgirksaeasrf
    rgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k92B (B:)
    nlflstqtiikealrklgypgdmyelmkepqrmltvripvkmdngsvkvftgyrsqhnda
    vgptkggvrfhpevneekvkalsiwmtlkcgianlpygggkggiicdprtmsfgelerls
    rgyvraisqivgptkdipapdvytnsqimawmmdeysrlrefdspgfitgkplvlggsqg
    retataqgvticieeavkkkgiklqnariiiqgfgnagsflakfmhdagakvigisdang
    glynpdgldipylldkrdsfgmvtnlftdvitneellekdcdilvpaaisnqitaknahn
    iqasivverangpttidatkilnergvllvpdilasaggvtvsyfewvqnnqgyywseee
    vaeklrsvmvssfetiyqtaathkvdmrlaaymtgirksaeasrfrgwv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3k92C (C:)
    msakqvskdeekealnlflstqtiikealrklgypgdmyelmkepqrmltvripvkmdng
    svkvftgyrsqhndavgptkggvrfhpevneekvkalsiwmtlkcgianlpygggkggii
    cdprtmsfgelerlsrgyvraisqivgptkdipapdvytnsqimawmmdeysrlrefdsp
    gfitgkplvlggsqgretataqgvticieeavkkkgiklqnariiiqgfgnagsflakfm
    hdagakvigisdangglynpdgldipylldkrdsfgmvtnlftdvitneellekdcdilv
    paaisnqitaknahniqasivverangpttidatkilnergvllvpdilasaggvtvsyf
    ewvqnnqgyywseeevaeklrsvmvssfetiyqtaathkvdmrlaaymtgirksaeasrf
    rgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k92C (C:)
    nlflstqtiikealrklgypgdmyelmkepqrmltvripvkmdngsvkvftgyrsqhnda
    vgptkggvrfhpevneekvkalsiwmtlkcgianlpygggkggiicdprtmsfgelerls
    rgyvraisqivgptkdipapdvytnsqimawmmdeysrlrefdspgfitgkplvlggsqg
    retataqgvticieeavkkkgiklqnariiiqgfgnagsflakfmhdagakvigisdang
    glynpdgldipylldkrdsfgmvtnlftdvitneellekdcdilvpaaisnqitaknahn
    iqasivverangpttidatkilnergvllvpdilasaggvtvsyfewvqnnqgyywseee
    vaeklrsvmvssfetiyqtaathkvdmrlaaymtgirksaeasrfrgwv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3k92D (D:)
    msakqvskdeekealnlflstqtiikealrklgypgdmyelmkepqrmltvripvkmdng
    svkvftgyrsqhndavgptkggvrfhpevneekvkalsiwmtlkcgianlpygggkggii
    cdprtmsfgelerlsrgyvraisqivgptkdipapdvytnsqimawmmdeysrlrefdsp
    gfitgkplvlggsqgretataqgvticieeavkkkgiklqnariiiqgfgnagsflakfm
    hdagakvigisdangglynpdgldipylldkrdsfgmvtnlftdvitneellekdcdilv
    paaisnqitaknahniqasivverangpttidatkilnergvllvpdilasaggvtvsyf
    ewvqnnqgyywseeevaeklrsvmvssfetiyqtaathkvdmrlaaymtgirksaeasrf
    rgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k92D (D:)
    nlflstqtiikealrklgypgdmyelmkepqrmltvripvkmdngsvkvftgyrsqhnda
    vgptkggvrfhpevneekvkalsiwmtlkcgianlpygggkggiicdprtmsfgelerls
    rgyvraisqivgptkdipapdvytnsqimawmmdeysrlrefdspgfitgkplvlggsqg
    retataqgvticieeavkkkgiklqnariiiqgfgnagsflakfmhdagakvigisdang
    glynpdgldipylldkrdmvtnlftdvitneellekdcdilvpaaisnqitaknahniqa
    sivverangpttidatkilnergvllvpdilasaggvtvsyfewvqnnqgyywseeevae
    klrsvmvssfetiyqtaathkvdmrlaaymtgirksaeasrfrgwv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3k92E (E:)
    msakqvskdeekealnlflstqtiikealrklgypgdmyelmkepqrmltvripvkmdng
    svkvftgyrsqhndavgptkggvrfhpevneekvkalsiwmtlkcgianlpygggkggii
    cdprtmsfgelerlsrgyvraisqivgptkdipapdvytnsqimawmmdeysrlrefdsp
    gfitgkplvlggsqgretataqgvticieeavkkkgiklqnariiiqgfgnagsflakfm
    hdagakvigisdangglynpdgldipylldkrdsfgmvtnlftdvitneellekdcdilv
    paaisnqitaknahniqasivverangpttidatkilnergvllvpdilasaggvtvsyf
    ewvqnnqgyywseeevaeklrsvmvssfetiyqtaathkvdmrlaaymtgirksaeasrf
    rgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k92E (E:)
    kealnlflstqtiikealrklgypgdmyelmkepqrmltvripvkmdngsvkvftgyrsq
    hndavgptkggvrfhpevneekvkalsiwmtlkcgianlpygggkggiicdprtmsfgel
    erlsrgyvraisqivgptkdipapdvytnsqimawmmdeysrlrefdspgfitgkplvlg
    gsqgretataqgvticieeavkkkgiklqnariiiqgfgnagsflakfmhdagakvigis
    dangglynpdgldipylltneellekdcdilvpaaisnqitaknahniqasivverangp
    ttidatkilnergvllvpdilasaggvtvsyfewvqnnqgyywseeevaeklrsvmvssf
    etiyqtaathkvdmrlaaymtgirksaeasrfrgwv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3k92F (F:)
    msakqvskdeekealnlflstqtiikealrklgypgdmyelmkepqrmltvripvkmdng
    svkvftgyrsqhndavgptkggvrfhpevneekvkalsiwmtlkcgianlpygggkggii
    cdprtmsfgelerlsrgyvraisqivgptkdipapdvytnsqimawmmdeysrlrefdsp
    gfitgkplvlggsqgretataqgvticieeavkkkgiklqnariiiqgfgnagsflakfm
    hdagakvigisdangglynpdgldipylldkrdsfgmvtnlftdvitneellekdcdilv
    paaisnqitaknahniqasivverangpttidatkilnergvllvpdilasaggvtvsyf
    ewvqnnqgyywseeevaeklrsvmvssfetiyqtaathkvdmrlaaymtgirksaeasrf
    rgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k92F (F:)
    alnlflstqtiikealrklgypgdmyelmkepqrmltvripvkmdngsvkvftgyrsqhn
    davgptkggvrfhpevneekvkalsiwmtlkcgianlpygggkggiicdprtmsfgeler
    lsrgyvraisqivgptkdipapdvytnsqimawmmdeysrlrefdspgfitgkplvlggs
    qgretataqgvticieeavkkkgiklqnariiiqgfgnagsflakfmhdagakvigisda
    ngglynpdgldipyllitneellekdcdilvpaaisnqitaknahniqasivverangpt
    tidatkilnergvllvpdilasaggvtvsyfewvqnnqgyywseeevaeklrsvmvssfe
    tiyqtaathkvdmrlaaymtgirksaeasrfrgwv