Lineage for d3k82a_ (3k82 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786234Protein automated matches [190055] (6 species)
    not a true protein
  7. 2786243Species Human (Homo sapiens) [TaxId:9606] [187785] (51 PDB entries)
  8. 2786264Domain d3k82a_: 3k82 A: [212196]
    automated match to d1tp3a1
    complexed with epe, gol, po4

Details for d3k82a_

PDB Entry: 3k82 (more details), 1.4 Å

PDB Description: crystal structure of the third pdz domain of psd-95
PDB Compounds: (A:) Disks large homolog 4

SCOPe Domain Sequences for d3k82a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k82a_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edipreprrivihrgstglgfnivggexgegifisfilaggpadlsgelrkgdqilsvng
vdlrnasheqaaialknagqtvtiiaqykpeeysrfea

SCOPe Domain Coordinates for d3k82a_:

Click to download the PDB-style file with coordinates for d3k82a_.
(The format of our PDB-style files is described here.)

Timeline for d3k82a_: