Lineage for d3iu2a1 (3iu2 A:115-295)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969076Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)
  8. 2969097Domain d3iu2a1: 3iu2 A:115-295 [211956]
    automated match to d1iyka1
    complexed with 096, mya

Details for d3iu2a1

PDB Entry: 3iu2 (more details), 1.73 Å

PDB Description: Crystal Structure of human type-I N-myristoyltransferase with bound myristoyl-CoA and inhibitor DDD90096
PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d3iu2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iu2a1 d.108.1.0 (A:115-295) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih
iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc
r

SCOPe Domain Coordinates for d3iu2a1:

Click to download the PDB-style file with coordinates for d3iu2a1.
(The format of our PDB-style files is described here.)

Timeline for d3iu2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3iu2a2