![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (22 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225745] (8 PDB entries) |
![]() | Domain d3iu2a1: 3iu2 A:115-295 [211956] automated match to d1iyka1 complexed with 096, mya |
PDB Entry: 3iu2 (more details), 1.73 Å
SCOPe Domain Sequences for d3iu2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iu2a1 d.108.1.0 (A:115-295) automated matches {Human (Homo sapiens) [TaxId: 9606]} rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc r
Timeline for d3iu2a1: