Lineage for d3hgba1 (3hgb A:23-155)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426782Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2426863Family b.84.1.0: automated matches [191593] (1 protein)
    not a true family
  6. 2426864Protein automated matches [191080] (7 species)
    not a true protein
  7. 2426882Species Mycobacterium tuberculosis [TaxId:83332] [225686] (1 PDB entry)
  8. 2426883Domain d3hgba1: 3hgb A:23-155 [211028]
    Other proteins in same PDB: d3hgba2
    automated match to d3ifta_

Details for d3hgba1

PDB Entry: 3hgb (more details), 1.75 Å

PDB Description: crystal structure of glycine cleavage system protein h from mycobacterium tuberculosis
PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d3hgba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hgba1 b.84.1.0 (A:23-155) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
msdipsdlhytaehewirrsgddtvrvgitdyaqsalgdvvfvqlpvigtavtagetfge
vestksvsdlyapisgkvsevnsdldgtpqlvnsdpygagwlldiqvdssdvaalesalt
tlldaeayrgtlt

SCOPe Domain Coordinates for d3hgba1:

Click to download the PDB-style file with coordinates for d3hgba1.
(The format of our PDB-style files is described here.)

Timeline for d3hgba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hgba2