Lineage for d3ifta_ (3ift A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1808932Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1808933Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 1809014Family b.84.1.0: automated matches [191593] (1 protein)
    not a true family
  6. 1809015Protein automated matches [191080] (7 species)
    not a true protein
  7. 1809031Species Mycobacterium tuberculosis [TaxId:1773] [189016] (1 PDB entry)
  8. 1809032Domain d3ifta_: 3ift A: [178301]
    automated match to d1onla_

Details for d3ifta_

PDB Entry: 3ift (more details), 2 Å

PDB Description: crystal structure of glycine cleavage system protein h from mycobacterium tuberculosis, using x-rays from the compact light source.
PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d3ifta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ifta_ b.84.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
hhvsdipsdlhytaehewirrsgddtvrvgitdyaqsalgdvvfvqlpvigtavtagetf
gevestksvsdlyapisgkvsevnsdldgtpqlvnsdpygagwlldiqvdssdvaalesa
lttlldaeayrgtlte

SCOPe Domain Coordinates for d3ifta_:

Click to download the PDB-style file with coordinates for d3ifta_.
(The format of our PDB-style files is described here.)

Timeline for d3ifta_: