PDB entry 3ift

View 3ift on RCSB PDB site
Description: Crystal structure of glycine cleavage system protein H from Mycobacterium tuberculosis, using X-rays from the Compact Light Source.
Class: oxidoreductase
Keywords: NIAID, DECODE, UW, SBRI, GLYCINE CLEAVAGE SYSTEM, Structural Genomics, PSI-2, Protein Structure Initiative, Accelerated Technologies Center for Gene to 3D Structure, ATCG3D, Seattle Structural Genomics Center for Infectious Disease, Lipoyl, methylamine binding protein, OXIDOREDUCTASE
Deposited on 2009-07-25, released 2009-08-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine cleavage system H protein
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: GCHV, gcvH, MT1874, MTCY1A11.17c, Rv1826
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q50607 (9-141)
      • expression tag (6-8)
    Domains in SCOPe 2.05: d3ifta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iftA (A:)
    mahhhhhhvsdipsdlhytaehewirrsgddtvrvgitdyaqsalgdvvfvqlpvigtav
    tagetfgevestksvsdlyapisgkvsevnsdldgtpqlvnsdpygagwlldiqvdssdv
    aalesalttlldaeayrgtlte
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iftA (A:)
    hhvsdipsdlhytaehewirrsgddtvrvgitdyaqsalgdvvfvqlpvigtavtagetf
    gevestksvsdlyapisgkvsevnsdldgtpqlvnsdpygagwlldiqvdssdvaalesa
    lttlldaeayrgtlte