Lineage for d3hgba_ (3hgb A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332005Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1332006Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 1332074Family b.84.1.0: automated matches [191593] (1 protein)
    not a true family
  6. 1332075Protein automated matches [191080] (5 species)
    not a true protein
  7. 1332088Species Mycobacterium tuberculosis [TaxId:83332] [225686] (1 PDB entry)
  8. 1332089Domain d3hgba_: 3hgb A: [211028]
    automated match to d3ifta_

Details for d3hgba_

PDB Entry: 3hgb (more details), 1.75 Å

PDB Description: crystal structure of glycine cleavage system protein h from mycobacterium tuberculosis
PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d3hgba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hgba_ b.84.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
smsdipsdlhytaehewirrsgddtvrvgitdyaqsalgdvvfvqlpvigtavtagetfg
evestksvsdlyapisgkvsevnsdldgtpqlvnsdpygagwlldiqvdssdvaalesal
ttlldaeayrgtlt

SCOPe Domain Coordinates for d3hgba_:

Click to download the PDB-style file with coordinates for d3hgba_.
(The format of our PDB-style files is described here.)

Timeline for d3hgba_: