| Class b: All beta proteins [48724] (174 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.0: automated matches [191593] (1 protein) not a true family |
| Protein automated matches [191080] (5 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [189016] (1 PDB entry) |
| Domain d3ifta_: 3ift A: [178301] automated match to d1onla_ |
PDB Entry: 3ift (more details), 2 Å
SCOPe Domain Sequences for d3ifta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ifta_ b.84.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
hhvsdipsdlhytaehewirrsgddtvrvgitdyaqsalgdvvfvqlpvigtavtagetf
gevestksvsdlyapisgkvsevnsdldgtpqlvnsdpygagwlldiqvdssdvaalesa
lttlldaeayrgtlte
Timeline for d3ifta_: