PDB entry 3hgb

View 3hgb on RCSB PDB site
Description: Crystal structure of glycine cleavage system protein H from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: SSGCID, NIAID, deCODE, UW, SBRI, Lipoyl, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, UNKNOWN FUNCTION, OXIDOREDUCTASE
Deposited on 2009-05-13, released 2009-05-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.183
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine cleavage system H protein
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: gcvH, Rv1826, MT1874, MTCY1A11.17c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q50607 (21-End)
      • expression tag (20)
    Domains in SCOPe 2.03: d3hgba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3hgbA (A:)
mahhhhhhmgtleaqtqgpgsmsdipsdlhytaehewirrsgddtvrvgitdyaqsalgd
vvfvqlpvigtavtagetfgevestksvsdlyapisgkvsevnsdldgtpqlvnsdpyga
gwlldiqvdssdvaalesalttlldaeayrgtlte

    Sequence, based on observed residues (ATOM records): (download) 
    >3hgbA (A:)
smsdipsdlhytaehewirrsgddtvrvgitdyaqsalgdvvfvqlpvigtavtagetfg
evestksvsdlyapisgkvsevnsdldgtpqlvnsdpygagwlldiqvdssdvaalesal
ttlldaeayrgtlt