Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins) |
Protein automated matches [190397] (2 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [187266] (21 PDB entries) |
Domain d3glja2: 3glj A:4-308 [210577] Other proteins in same PDB: d3glja1 automated match to d1kwma1 complexed with gol, zn |
PDB Entry: 3glj (more details), 1.89 Å
SCOPe Domain Sequences for d3glja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3glja2 c.56.5.1 (A:4-308) automated matches {Pig (Sus scrofa) [TaxId: 9823]} ttghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaif mdcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtkn rmwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfi rnnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygp gattiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtn yvlghl
Timeline for d3glja2: