SCOPe 2.03: Domain d3glja2: 3glj A:4-308

Lineage for d3glja2 (3glj A:4-308)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein automated matches [190397] (2 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [187266] (21 PDB entries)

8. Domain d3glja2: 3glj A:4-308 [210577]
   Other proteins in same PDB: d3glja1
   automated match to d1kwma1
   complexed with gol, zn

Details for d3glja2

PDB Entry: 3glj, 1.89 Å

PDB Description: a polymorph of carboxypeptidase b zymogen structure

PDB Compounds: (A:) carboxypeptidase b

SCOPe Domain Sequences for d3glja2:

Sequence; same for both SEQRES and ATOM records:

>d3glja2 c.56.5.1 (A:4-308) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
ttghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaif
mdcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtkn
rmwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfi
rnnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygp
gattiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtn
yvlghl

Timeline for d3glja2:

• d3glja2 is new in SCOPe 2.03-stable
  
• d3glja2 appears in SCOPe 2.04
  
• d3glja2 appears in the current release, SCOPe 2.08