SCOPe 2.04: Domain d3glja1: 3glj A:7A-95A

Lineage for d3glja1 (3glj A:7A-95A)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families)

5. Family d.58.3.0: automated matches [227247] (1 protein)
   not a true family

6. Protein automated matches [227020] (1 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [225769] (1 PDB entry)

8. Domain d3glja1: 3glj A:7A-95A [210576]
   Other proteins in same PDB: d3glja2
   automated match to d1kwma2
   complexed with gol, zn

Details for d3glja1

PDB Entry: 3glj, 1.89 Å

PDB Description: a polymorph of carboxypeptidase b zymogen structure

PDB Compounds: (A:) carboxypeptidase b

SCOPe Domain Sequences for d3glja1:

Sequence; same for both SEQRES and ATOM records:

>d3glja1 d.58.3.0 (A:7A-95A) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
fegekvfrvnvedendisllhelastrqidfwkpdsvtqikphstvdfrvkaedilaved
fleqnelqyevlinnlrsvleaqfdsrvr

Timeline for d3glja1:

• d3glja1 first appeared in SCOPe 2.03
  
• d3glja1 appears in SCOPe 2.05
  
• d3glja1 appears in the current release, SCOPe 2.08