Lineage for d3glja1 (3glj A:7A-95A)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949661Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) (S)
  5. 2949704Family d.58.3.0: automated matches [227247] (1 protein)
    not a true family
  6. 2949705Protein automated matches [227020] (1 species)
    not a true protein
  7. 2949706Species Pig (Sus scrofa) [TaxId:9823] [225769] (1 PDB entry)
  8. 2949707Domain d3glja1: 3glj A:7A-95A [210576]
    Other proteins in same PDB: d3glja2
    automated match to d1kwma2
    complexed with gol, zn

Details for d3glja1

PDB Entry: 3glj (more details), 1.89 Å

PDB Description: a polymorph of carboxypeptidase b zymogen structure
PDB Compounds: (A:) carboxypeptidase b

SCOPe Domain Sequences for d3glja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3glja1 d.58.3.0 (A:7A-95A) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
fegekvfrvnvedendisllhelastrqidfwkpdsvtqikphstvdfrvkaedilaved
fleqnelqyevlinnlrsvleaqfdsrvr

SCOPe Domain Coordinates for d3glja1:

Click to download the PDB-style file with coordinates for d3glja1.
(The format of our PDB-style files is described here.)

Timeline for d3glja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3glja2