![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) ![]() |
![]() | Family d.58.3.0: automated matches [227247] (1 protein) not a true family |
![]() | Protein automated matches [227020] (1 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [225769] (1 PDB entry) |
![]() | Domain d3glja1: 3glj A:7A-95A [210576] Other proteins in same PDB: d3glja2 automated match to d1kwma2 complexed with gol, zn |
PDB Entry: 3glj (more details), 1.89 Å
SCOPe Domain Sequences for d3glja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3glja1 d.58.3.0 (A:7A-95A) automated matches {Pig (Sus scrofa) [TaxId: 9823]} fegekvfrvnvedendisllhelastrqidfwkpdsvtqikphstvdfrvkaedilaved fleqnelqyevlinnlrsvleaqfdsrvr
Timeline for d3glja1: