SCOPe 2.05: Domain d3gg5d_: 3gg5 D:

Lineage for d3gg5d_ (3gg5 D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189245] (8 PDB entries)

8. Domain d3gg5d_: 3gg5 D: [210526]
   automated match to d2aaza_
   complexed with po4, so4

Details for d3gg5d_

PDB Entry: 3gg5, 2.77 Å

PDB Description: replacement of val3 in human thymidylate synthase affects its kinetic properties and intracellular stability

PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d3gg5d_:

Sequence; same for both SEQRES and ATOM records:

>d3gg5d_ d.117.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptik

Timeline for d3gg5d_:

• d3gg5d_ first appeared in SCOPe 2.03
  
• d3gg5d_ appears in SCOPe 2.04
  
• d3gg5d_ appears in SCOPe 2.06
  
• d3gg5d_ appears in the current release, SCOPe 2.08