Lineage for d3gg5d_ (3gg5 D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1666639Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1666640Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1666641Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1666899Protein automated matches [190469] (12 species)
    not a true protein
  7. 1666949Species Human (Homo sapiens) [TaxId:9606] [189245] (16 PDB entries)
  8. 1666983Domain d3gg5d_: 3gg5 D: [210526]
    automated match to d2aaza_
    complexed with po4, so4

Details for d3gg5d_

PDB Entry: 3gg5 (more details), 2.77 Å

PDB Description: replacement of val3 in human thymidylate synthase affects its kinetic properties and intracellular stability
PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d3gg5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gg5d_ d.117.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptik

SCOPe Domain Coordinates for d3gg5d_:

Click to download the PDB-style file with coordinates for d3gg5d_.
(The format of our PDB-style files is described here.)

Timeline for d3gg5d_: