Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein automated matches [190469] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189245] (16 PDB entries) |
Domain d3gg5d_: 3gg5 D: [210526] automated match to d2aaza_ complexed with po4, so4 |
PDB Entry: 3gg5 (more details), 2.77 Å
SCOPe Domain Sequences for d3gg5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gg5d_ d.117.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptik
Timeline for d3gg5d_: