Lineage for d3gg5a_ (3gg5 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1923787Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1923788Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1923789Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1924078Protein automated matches [190469] (12 species)
    not a true protein
  7. 1924127Species Human (Homo sapiens) [TaxId:9606] [189245] (8 PDB entries)
  8. 1924142Domain d3gg5a_: 3gg5 A: [210523]
    automated match to d2aaza_
    complexed with po4, so4

Details for d3gg5a_

PDB Entry: 3gg5 (more details), 2.77 Å

PDB Description: replacement of val3 in human thymidylate synthase affects its kinetic properties and intracellular stability
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d3gg5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gg5a_ d.117.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptik

SCOPe Domain Coordinates for d3gg5a_:

Click to download the PDB-style file with coordinates for d3gg5a_.
(The format of our PDB-style files is described here.)

Timeline for d3gg5a_: