Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (35 species) not a true protein |
Species Xanthomonas campestris [TaxId:340] [225616] (1 PDB entry) |
Domain d3g8za_: 3g8z A: [210457] automated match to d1tuha_ complexed with cl, gol |
PDB Entry: 3g8z (more details), 1.9 Å
SCOPe Domain Sequences for d3g8za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g8za_ d.17.4.0 (A:) automated matches {Xanthomonas campestris [TaxId: 340]} mntidiaksyitaiqtgdhatlgsiispdviwhqpgnhqfsgthrgmavvgpmlgkmmev sngtfaisraddymasgdwvaitlefsgqangvtlkqagvdllriedgkivevrlfsadq tqedafwgr
Timeline for d3g8za_: