Lineage for d3g8za_ (3g8z A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405776Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1405777Protein automated matches [190205] (13 species)
    not a true protein
  7. 1405834Species Xanthomonas campestris [TaxId:340] [225616] (1 PDB entry)
  8. 1405835Domain d3g8za_: 3g8z A: [210457]
    automated match to d1tuha_
    complexed with cl, gol

Details for d3g8za_

PDB Entry: 3g8z (more details), 1.9 Å

PDB Description: crystal structure of protein of unknown function with cystatin-like fold (np_639274.1) from xanthomonas campestris at 1.90 a resolution
PDB Compounds: (A:) Protein of unknown function with cystatin-like fold

SCOPe Domain Sequences for d3g8za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g8za_ d.17.4.0 (A:) automated matches {Xanthomonas campestris [TaxId: 340]}
mntidiaksyitaiqtgdhatlgsiispdviwhqpgnhqfsgthrgmavvgpmlgkmmev
sngtfaisraddymasgdwvaitlefsgqangvtlkqagvdllriedgkivevrlfsadq
tqedafwgr

SCOPe Domain Coordinates for d3g8za_:

Click to download the PDB-style file with coordinates for d3g8za_.
(The format of our PDB-style files is described here.)

Timeline for d3g8za_: