Lineage for d1tuha_ (1tuh A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405600Family d.17.4.11: Hypothetical protein egc068 from a soil-derived mobile gene cassette [110826] (1 protein)
    automatically mapped to Pfam PF07858
  6. 1405601Protein Hypothetical protein egc068 from a soil-derived mobile gene cassette [110827] (1 species)
  7. 1405602Species uncultured organism [TaxId:155900] [110828] (1 PDB entry)
    Uniprot Q99IU3
  8. 1405603Domain d1tuha_: 1tuh A: [107345]
    complexed with act

Details for d1tuha_

PDB Entry: 1tuh (more details), 1.85 Å

PDB Description: Structure of Bal32a from a Soil-Derived Mobile Gene Cassette
PDB Compounds: (A:) hypothetical protein EGC068

SCOPe Domain Sequences for d1tuha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]}
neaeqnaetvrrgyaafnsgdmktltelfdenaswhtpgrsriagdhkgreaifaqfgry
ggetggtfkavllhvlksddgrvigihrntaerggkrldvgccivfefkngrvidgrehf
ydlyawdefwr

SCOPe Domain Coordinates for d1tuha_:

Click to download the PDB-style file with coordinates for d1tuha_.
(The format of our PDB-style files is described here.)

Timeline for d1tuha_: