PDB entry 3g8z

View 3g8z on RCSB PDB site
Description: Crystal structure of protein of unknown function with cystatin-like fold (NP_639274.1) from Xanthomonas campestris at 1.90 A resolution
Class: structural genomics, unknown function
Keywords: NP_639274.1, SnoaL-like polyketide cyclase, protein of unknown function with cystatin-like fold, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, UNKNOWN FUNCTION
Deposited on 2009-02-12, released 2009-02-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein of unknown function with cystatin-like fold
    Species: Xanthomonas campestris pv. campestris [TaxId:340]
    Gene: NP_639274.1, XCC3934
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3g8za_
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g8zA (A:)
    mgsdkihhhhhhenlyfqgmntidiaksyitaiqtgdhatlgsiispdviwhqpgnhqfs
    gthrgmavvgpmlgkmmevsngtfaisraddymasgdwvaitlefsgqangvtlkqagvd
    llriedgkivevrlfsadqtqedafwgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g8zA (A:)
    mntidiaksyitaiqtgdhatlgsiispdviwhqpgnhqfsgthrgmavvgpmlgkmmev
    sngtfaisraddymasgdwvaitlefsgqangvtlkqagvdllriedgkivevrlfsadq
    tqedafwgr