Lineage for d3frca2 (3frc A:86-209)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713507Protein Pf GST [101210] (1 species)
    cannot be assigned to any of the known GST classes
  7. 2713508Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [101211] (6 PDB entries)
  8. 2713509Domain d3frca2: 3frc A:86-209 [210079]
    Other proteins in same PDB: d3frca1, d3frcb1
    automated match to d1okta1
    complexed with 0hg

Details for d3frca2

PDB Entry: 3frc (more details), 2 Å

PDB Description: Tetramerization and Cooperativity in Plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3frca2:

Sequence, based on SEQRES records: (download)

>d3frca2 a.45.1.1 (A:86-209) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn
nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn
rkes

Sequence, based on observed residues (ATOM records): (download)

>d3frca2 a.45.1.1 (A:86-209) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn
nyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitnrkes

SCOPe Domain Coordinates for d3frca2:

Click to download the PDB-style file with coordinates for d3frca2.
(The format of our PDB-style files is described here.)

Timeline for d3frca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3frca1