Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Pf GST [101210] (1 species) cannot be assigned to any of the known GST classes |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [101211] (6 PDB entries) |
Domain d3frcb2: 3frc B:86-211 [210081] Other proteins in same PDB: d3frca1, d3frcb1 automated match to d1okta1 complexed with 0hg |
PDB Entry: 3frc (more details), 2 Å
SCOPe Domain Sequences for d3frcb2:
Sequence, based on SEQRES records: (download)
>d3frcb2 a.45.1.1 (B:86-211) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn rkesvy
>d3frcb2 a.45.1.1 (B:86-211) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhnd kyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitnrkes vy
Timeline for d3frcb2: