SCOPe 2.07: Domain d3fj4b2: 3fj4 B:133-374

Lineage for d3fj4b2 (3fj4 B:133-374)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (78 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:220664] [225447] (3 PDB entries)

8. Domain d3fj4b2: 3fj4 B:133-374 [209950]
   Other proteins in same PDB: d3fj4a1, d3fj4b1
   automated match to d1f9ca1
   complexed with mg, muc

Details for d3fj4b2

PDB Entry: 3fj4, 1.8 Å

PDB Description: crystal structure of muconate lactonizing enzyme from pseudomonas fluorescens complexed with muconolactone

PDB Compounds: (B:) Muconate cycloisomerase

SCOPe Domain Sequences for d3fj4b2:

Sequence; same for both SEQRES and ATOM records:

>d3fj4b2 c.1.11.0 (B:133-374) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
rvrdalpvawtlasgdtakdiaeaqkmldlrrhrifklkigagevdrdlahviaikkalg
dsasvrvdvnqawdeavalracrilggngidlieqpisrnnragmvrlnasspapimade
siecvedafnlaregaasvfalkiaknggpratlrtaaiaeaagiglyggtmleggigtl
asahafltlnklswdtelfgpllltedilaeppvyrdfhlhvskapglglsldeerlaff
rr

Timeline for d3fj4b2:

• d3fj4b2 first appeared in SCOPe 2.03
  
• d3fj4b2 appears in SCOPe 2.06
  
• d3fj4b2 appears in the current release, SCOPe 2.08