| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (79 species) not a true protein |
| Species Pseudomonas fluorescens [TaxId:220664] [225447] (3 PDB entries) |
| Domain d3fj4b2: 3fj4 B:133-374 [209950] Other proteins in same PDB: d3fj4a1, d3fj4b1 automated match to d1f9ca1 complexed with mg, muc |
PDB Entry: 3fj4 (more details), 1.8 Å
SCOPe Domain Sequences for d3fj4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fj4b2 c.1.11.0 (B:133-374) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
rvrdalpvawtlasgdtakdiaeaqkmldlrrhrifklkigagevdrdlahviaikkalg
dsasvrvdvnqawdeavalracrilggngidlieqpisrnnragmvrlnasspapimade
siecvedafnlaregaasvfalkiaknggpratlrtaaiaeaagiglyggtmleggigtl
asahafltlnklswdtelfgpllltedilaeppvyrdfhlhvskapglglsldeerlaff
rr
Timeline for d3fj4b2: