Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Pseudomonas fluorescens [TaxId:220664] [225446] (3 PDB entries) |
Domain d3fj4a1: 3fj4 A:4-132 [209947] Other proteins in same PDB: d3fj4a2, d3fj4b2 automated match to d1f9ca2 complexed with mg, muc |
PDB Entry: 3fj4 (more details), 1.8 Å
SCOPe Domain Sequences for d3fj4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fj4a1 d.54.1.0 (A:4-132) automated matches {Pseudomonas fluorescens [TaxId: 220664]} hasaiesietiivdlptirphklamhtmqnqtlvlirlrcadgieglgesttigglaygn espdsiktnidrfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgkrlg lpvsellgg
Timeline for d3fj4a1: