SCOPe 2.08: Domain d3fhba1: 3fhb A:178-321

Lineage for d3fhba1 (3fhb A:178-321)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225405] (62 PDB entries)

8. Domain d3fhba1: 3fhb A:178-321 [209921]
   Other proteins in same PDB: d3fhba2, d3fhba3
   automated match to d1gs0a1
   complexed with gab

Details for d3fhba1

PDB Entry: 3fhb, 2.3 Å

PDB Description: human poly(adp-ribose) polymerase 3, catalytic fragment in complex with an inhibitor 3-aminobenzoic acid

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 3

SCOPe Domain Sequences for d3fhba1:

Sequence; same for both SEQRES and ATOM records:

>d3fhba1 a.41.1.0 (A:178-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealeale
ealkgptdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladielaqa
lqavseqektveevphpldrdyql

Timeline for d3fhba1:

• d3fhba1 first appeared in SCOPe 2.03
  
• d3fhba1 appears in SCOPe 2.07