Lineage for d3fdsd2 (3fds D:128-245)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1927131Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1927132Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1927500Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 1927501Protein automated matches [226907] (12 species)
    not a true protein
  7. 1927546Species Sulfolobus solfataricus [TaxId:2287] [225132] (4 PDB entries)
  8. 1927548Domain d3fdsd2: 3fds D:128-245 [209863]
    Other proteins in same PDB: d3fdsa1, d3fdsa2
    automated match to d1ud9a2
    protein/DNA complex; complexed with 1pe, edo, gol, peg, pge

Details for d3fdsd2

PDB Entry: 3fds (more details), 2.05 Å

PDB Description: structural insight into recruitment of translesion dna polymerase dpo4 to sliding clamp pcna
PDB Compounds: (D:) DNA polymerase sliding clamp c

SCOPe Domain Sequences for d3fdsd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fdsd2 d.131.1.0 (D:128-245) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
efpfkaqlltitfadiidelsdlgevlnihskenklyfevigdlstakvelstdngtlle
asgadvsssygmeyvanttkmrrasdsmelyfgsqiplklrfklpqegygdfyiapra

SCOPe Domain Coordinates for d3fdsd2:

Click to download the PDB-style file with coordinates for d3fdsd2.
(The format of our PDB-style files is described here.)

Timeline for d3fdsd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fdsd1