![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
![]() | Protein automated matches [226907] (20 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [225132] (4 PDB entries) |
![]() | Domain d3fdsd2: 3fds D:128-245 [209863] Other proteins in same PDB: d3fdsa1, d3fdsa2 automated match to d1ud9a2 protein/DNA complex; complexed with 1pe, edo, gol, peg, pge |
PDB Entry: 3fds (more details), 2.05 Å
SCOPe Domain Sequences for d3fdsd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fdsd2 d.131.1.0 (D:128-245) automated matches {Sulfolobus solfataricus [TaxId: 2287]} efpfkaqlltitfadiidelsdlgevlnihskenklyfevigdlstakvelstdngtlle asgadvsssygmeyvanttkmrrasdsmelyfgsqiplklrfklpqegygdfyiapra
Timeline for d3fdsd2: