Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (12 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [225132] (4 PDB entries) |
Domain d3fdsd1: 3fds D:1-127 [209862] Other proteins in same PDB: d3fdsa1, d3fdsa2 automated match to d1ud9a1 protein/DNA complex; complexed with 1pe, edo, gol, peg, pge |
PDB Entry: 3fds (more details), 2.05 Å
SCOPe Domain Sequences for d3fdsd1:
Sequence, based on SEQRES records: (download)
>d3fdsd1 d.131.1.0 (D:1-127) automated matches {Sulfolobus solfataricus [TaxId: 2287]} mmkakvidavsfsyilrtvgdflseanfivtkegirvsgidpsrvvfldiflpssyfegf evsqekeiigfkledvndilkrvlkddtlilssneskltltfdgeftrsfelpliqvest qppsvnl
>d3fdsd1 d.131.1.0 (D:1-127) automated matches {Sulfolobus solfataricus [TaxId: 2287]} mmkakvidavsfsyilrtvgdflseanfivtkegirvsgidpsrvvfldiflpssyfegf evsqekeiigfkledvndilkrvlkddtlilssneskltltfdgeftrsfelpliqvest qpl
Timeline for d3fdsd1: