Lineage for d3f2ua_ (3f2u A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537732Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 1537770Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 1537815Protein Heterochromatin protein 1, HP1 [54166] (4 species)
    duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain
  7. 1537823Species Human (Homo sapiens) [TaxId:9606] [187099] (3 PDB entries)
  8. 1537828Domain d3f2ua_: 3f2u A: [209778]
    automated match to d1q3la_

Details for d3f2ua_

PDB Entry: 3f2u (more details), 1.8 Å

PDB Description: Crystal structure of human chromobox homolog 1 (CBX1)
PDB Compounds: (A:) chromobox protein homolog 1

SCOPe Domain Sequences for d3f2ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f2ua_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Human (Homo sapiens) [TaxId: 9606]}
geyvvekvldrrvvkgkveyllkwkgfsdedntwepeenldcpdliaeflq

SCOPe Domain Coordinates for d3f2ua_:

Click to download the PDB-style file with coordinates for d3f2ua_.
(The format of our PDB-style files is described here.)

Timeline for d3f2ua_: