PDB entry 3f2u

View 3f2u on RCSB PDB site
Description: Crystal structure of human chromobox homolog 1 (CBX1)
Class: protein binding
Keywords: Human chromobox homolog 1, CBX1, Structural Genomics, Structural Genomics Consortium, SGC, Centromere, Nucleus, Phosphoprotein, PROTEIN BINDING
Deposited on 2008-10-30, released 2008-11-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.224
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chromobox protein homolog 1
  Species: Homo sapiens [TaxId:9606]
  Gene: CBX1, CBX
  Database cross-references and differences (RAF-indexed):
  • Uniprot P83916 (1-End)
    • expression tag (0)
  Domains in SCOPe 2.04: d3f2ua_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3f2uA (A:)
  geyvvekvldrrvvkgkveyllkwkgfsdedntwepeenldcpdliaeflqsqkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3f2uA (A:)
  geyvvekvldrrvvkgkveyllkwkgfsdedntwepeenldcpdliaeflq