Lineage for d3f2ua1 (3f2u A:2-51)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785079Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2785124Protein Heterochromatin protein 1, HP1 [54166] (4 species)
    duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain
  7. 2785132Species Human (Homo sapiens) [TaxId:9606] [187099] (3 PDB entries)
  8. 2785137Domain d3f2ua1: 3f2u A:2-51 [209778]
    Other proteins in same PDB: d3f2ua2
    automated match to d1q3la_

Details for d3f2ua1

PDB Entry: 3f2u (more details), 1.8 Å

PDB Description: Crystal structure of human chromobox homolog 1 (CBX1)
PDB Compounds: (A:) chromobox protein homolog 1

SCOPe Domain Sequences for d3f2ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f2ua1 b.34.13.2 (A:2-51) Heterochromatin protein 1, HP1 {Human (Homo sapiens) [TaxId: 9606]}
eyvvekvldrrvvkgkveyllkwkgfsdedntwepeenldcpdliaeflq

SCOPe Domain Coordinates for d3f2ua1:

Click to download the PDB-style file with coordinates for d3f2ua1.
(The format of our PDB-style files is described here.)

Timeline for d3f2ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f2ua2