Lineage for d3cfwa1 (3cfw A:1-118)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1940571Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1941004Protein automated matches [190329] (8 species)
    not a true protein
  7. 1941017Species Human (Homo sapiens) [TaxId:9606] [187151] (9 PDB entries)
  8. 1941029Domain d3cfwa1: 3cfw A:1-118 [208875]
    Other proteins in same PDB: d3cfwa2
    automated match to d1g1sa1
    complexed with ca, nag

Details for d3cfwa1

PDB Entry: 3cfw (more details), 2.2 Å

PDB Description: l-selectin lectin and egf domains
PDB Compounds: (A:) L-selectin

SCOPe Domain Sequences for d3cfwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfwa1 d.169.1.1 (A:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wtyhysekpmnwqrarrfcrdnytdlvaiqnkaeieylektlpfsrsyywigirkiggiw
twvgtnkslteeaenwgdgepnnkknkedcveiyikrnkdagkwnddachklkaalcy

SCOPe Domain Coordinates for d3cfwa1:

Click to download the PDB-style file with coordinates for d3cfwa1.
(The format of our PDB-style files is described here.)

Timeline for d3cfwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cfwa2