Class g: Small proteins [56992] (92 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
Protein automated matches [226968] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225423] (24 PDB entries) |
Domain d3cfwa2: 3cfw A:119-156 [208876] Other proteins in same PDB: d3cfwa1 automated match to d1g1qa2 complexed with ca, nag |
PDB Entry: 3cfw (more details), 2.2 Å
SCOPe Domain Sequences for d3cfwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cfwa2 g.3.11.0 (A:119-156) automated matches {Human (Homo sapiens) [TaxId: 9606]} tascqpwscsghgecveiinnytcncdvgyygpqcqfv
Timeline for d3cfwa2: