| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein automated matches [190329] (10 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187151] (10 PDB entries) |
| Domain d3cfwa1: 3cfw A:1-118 [208875] Other proteins in same PDB: d3cfwa2 automated match to d1g1sa1 complexed with ca, nag |
PDB Entry: 3cfw (more details), 2.2 Å
SCOPe Domain Sequences for d3cfwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cfwa1 d.169.1.1 (A:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wtyhysekpmnwqrarrfcrdnytdlvaiqnkaeieylektlpfsrsyywigirkiggiw
twvgtnkslteeaenwgdgepnnkknkedcveiyikrnkdagkwnddachklkaalcy
Timeline for d3cfwa1: