Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
Protein Multidrug binding protein QacR [68964] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries) Uniprot P23217 |
Domain d3br5b1: 3br5 B:3-72 [208710] Other proteins in same PDB: d3br5a2, d3br5b2, d3br5d2, d3br5e2 automated match to d1jt6a1 protein/DNA complex; complexed with rhq, so4; mutant |
PDB Entry: 3br5 (more details), 2.9 Å
SCOPe Domain Sequences for d3br5b1:
Sequence, based on SEQRES records: (download)
>d3br5b1 a.4.1.9 (B:3-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} lkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskwq eqwkseqikc
>d3br5b1 a.4.1.9 (B:3-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} lkdkilgvakelfikngynatttgeivklsesskgnlyfktkenlfleilnieeskwqeq wkseqikc
Timeline for d3br5b1: