SCOPe 2.06: Domain d3br5b1: 3br5 B:3-72

Lineage for d3br5b1 (3br5 B:3-72)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Multidrug binding protein QacR [68964] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
   Uniprot P23217

8. Domain d3br5b1: 3br5 B:3-72 [208710]
   Other proteins in same PDB: d3br5a2, d3br5b2, d3br5d2, d3br5e2
   automated match to d1jt6a1
   protein/DNA complex; complexed with rhq, so4; mutant

Details for d3br5b1

PDB Entry: 3br5, 2.9 Å

PDB Description: crystal structure of the complex of rhodamine 6g bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor

PDB Compounds: (B:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d3br5b1:

Sequence, based on SEQRES records:

>d3br5b1 a.4.1.9 (B:3-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
lkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskwq
eqwkseqikc

Sequence, based on observed residues (ATOM records):

>d3br5b1 a.4.1.9 (B:3-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
lkdkilgvakelfikngynatttgeivklsesskgnlyfktkenlfleilnieeskwqeq
wkseqikc

Timeline for d3br5b1:

• d3br5b1 first appeared in SCOPe 2.03
  
• d3br5b1 appears in SCOPe 2.05
  
• d3br5b1 appears in SCOPe 2.07
  
• d3br5b1 appears in the current release, SCOPe 2.08