Lineage for d3br5b1 (3br5 B:3-72)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692295Protein Multidrug binding protein QacR [68964] (1 species)
  7. 2692296Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
    Uniprot P23217
  8. 2692356Domain d3br5b1: 3br5 B:3-72 [208710]
    Other proteins in same PDB: d3br5a2, d3br5b2, d3br5d2, d3br5e2
    automated match to d1jt6a1
    protein/DNA complex; complexed with rhq, so4; mutant

Details for d3br5b1

PDB Entry: 3br5 (more details), 2.9 Å

PDB Description: crystal structure of the complex of rhodamine 6g bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
PDB Compounds: (B:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d3br5b1:

Sequence, based on SEQRES records: (download)

>d3br5b1 a.4.1.9 (B:3-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
lkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskwq
eqwkseqikc

Sequence, based on observed residues (ATOM records): (download)

>d3br5b1 a.4.1.9 (B:3-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
lkdkilgvakelfikngynatttgeivklsesskgnlyfktkenlfleilnieeskwqeq
wkseqikc

SCOPe Domain Coordinates for d3br5b1:

Click to download the PDB-style file with coordinates for d3br5b1.
(The format of our PDB-style files is described here.)

Timeline for d3br5b1: