SCOPe 2.04: Domain d3bjua1: 3bju A:70-221

Lineage for d3bjua1 (3bju A:70-221)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225402] (6 PDB entries)

8. Domain d3bjua1: 3bju A:70-221 [208647]
   Other proteins in same PDB: d3bjua2, d3bjub2, d3bjuc2, d3bjud2
   automated match to d1bbua1
   complexed with atp, ca, lys

Details for d3bjua1

PDB Entry: 3bju, 2.31 Å

PDB Description: crystal structure of tetrameric form of human lysyl-trna synthetase

PDB Compounds: (A:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d3bjua1:

Sequence, based on SEQRES records:

>d3bjua1 b.40.4.0 (A:70-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkva
grihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpg
ktkkgelsiipyeitllspclhmlphlhfglk

Sequence, based on observed residues (ATOM records):

>d3bjua1 b.40.4.0 (A:70-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkva
grihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpg
ktkkgelsiipyeitllspclhmlphlk

Timeline for d3bjua1:

• d3bjua1 first appeared in SCOPe 2.03
  
• d3bjua1 appears in SCOPe 2.05
  
• d3bjua1 appears in the current release, SCOPe 2.08