PDB entry 3bju

View 3bju on RCSB PDB site
Description: Crystal Structure of tetrameric form of human lysyl-tRNA synthetase
Class: ligase
Keywords: tRNA synthetase, Lysyl-tRNA, Aminoacyl-tRNA synthetase, ATP-binding, Cytoplasm, Ligase, Nucleotide-binding, Phosphoprotein, Polymorphism, Protein biosynthesis
Deposited on 2007-12-04, released 2008-02-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.197
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: KARS, KIAA0070
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bjua1, d3bjua2
  • Chain 'B':
    Compound: lysyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: KARS, KIAA0070
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bjub1, d3bjub2
  • Chain 'C':
    Compound: lysyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: KARS, KIAA0070
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bjuc1, d3bjuc2
  • Chain 'D':
    Compound: lysyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: KARS, KIAA0070
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bjud1, d3bjud2
  • Heterogens: CA, LYS, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bjuA (A:)
    msvdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkv
    agrihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnp
    gktkkgelsiipyeitllspclhmlphlhfglkdketryrqryldlilndfvrqkfiirs
    kiityirsfldelgfleietpmmniipggavakpfityhneldmnlymriapelyhkmlv
    vggidrvyeigrqfrnegidlthnpefttcefymayadyhdlmeitekmvsgmvkhitgs
    ykvtyhpdgpegqaydvdftppfrrinmveelekalgmklpetnlfeteetrkilddicv
    akavecppprttarlldklvgeflevtcinptficdhpqimsplakwhrskeglterfel
    fvmkkeicnaytelndpmrqrqlfeeqakakaagddeamfidenfctaleyglpptagwg
    mgidrvamfltdsnnikevllfpamkpedkkenlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bjuA (A:)
    svdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkva
    grihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpg
    ktkkgelsiipyeitllspclhmlphlkdketryrqryldlilndfvrqkfiirskiity
    irsfldelgfleietpmmniipggavakpfityhneldmnlymriapelyhkmlvvggid
    rvyeigrqfrnegidlthnpefttcefymayadyhdlmeitekmvsgmvkhitgsykvty
    hpdgpegqaydvdftppfrrinmveelekalgmklpetnlfeteetrkilddicvakave
    cppprttarlldklvgeflevtcinptficdhpqimsplakwhrskeglterfelfvmkk
    eicnaytelndpmrqrqlfeeqakakaagddeamfidenfctaleyglpptagwgmgidr
    vamfltdsnnikevllfpamkpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bjuB (B:)
    msvdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkv
    agrihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnp
    gktkkgelsiipyeitllspclhmlphlhfglkdketryrqryldlilndfvrqkfiirs
    kiityirsfldelgfleietpmmniipggavakpfityhneldmnlymriapelyhkmlv
    vggidrvyeigrqfrnegidlthnpefttcefymayadyhdlmeitekmvsgmvkhitgs
    ykvtyhpdgpegqaydvdftppfrrinmveelekalgmklpetnlfeteetrkilddicv
    akavecppprttarlldklvgeflevtcinptficdhpqimsplakwhrskeglterfel
    fvmkkeicnaytelndpmrqrqlfeeqakakaagddeamfidenfctaleyglpptagwg
    mgidrvamfltdsnnikevllfpamkpedkkenlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bjuB (B:)
    dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr
    ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt
    kkgelsiipyeitllspclhmlpketryrqryldlilndfvrqkfiirskiityirsfld
    elgfleietpmmniipggavakpfityhneldmnlymriapelyhkmlvvggidrvyeig
    rqfrnegidlthnpefttcefymayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpe
    gqaydvdftppfrrinmveelekalgmklpetnlfeteetrkilddicvakavecppprt
    tarlldklvgeflevtcinptficdhpqimsplakwhrskeglterfelfvmkkeicnay
    telndpmrqrqlfeeqakakaagddeamfidenfctaleyglpptagwgmgidrvamflt
    dsnnikevllfpamk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bjuC (C:)
    msvdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkv
    agrihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnp
    gktkkgelsiipyeitllspclhmlphlhfglkdketryrqryldlilndfvrqkfiirs
    kiityirsfldelgfleietpmmniipggavakpfityhneldmnlymriapelyhkmlv
    vggidrvyeigrqfrnegidlthnpefttcefymayadyhdlmeitekmvsgmvkhitgs
    ykvtyhpdgpegqaydvdftppfrrinmveelekalgmklpetnlfeteetrkilddicv
    akavecppprttarlldklvgeflevtcinptficdhpqimsplakwhrskeglterfel
    fvmkkeicnaytelndpmrqrqlfeeqakakaagddeamfidenfctaleyglpptagwg
    mgidrvamfltdsnnikevllfpamkpedkkenlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bjuC (C:)
    dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr
    ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt
    kkgelsiipyeitllspclhmlphglkdketryrqryldlilndfvrqkfiirskiityi
    rsfldelgfleietpmmniipggavakpfityhneldmnlymriapelyhkmlvvggidr
    vyeigrqfrnegidlthnpefttcefymayadyhdlmeitekmvsgmvkhitgsykvtyh
    pdgpegqaydvdftppfrrinmveelekalgmklpetnlfeteetrkilddicvakavec
    ppprttarlldklvgeflevtcinptficdhpqimsplakwhrskeglterfelfvmkke
    icnaytelndpmrqrqlfeeqakakaagddeamfidenfctaleyglpptagwgmgidrv
    amfltdsnnikevllfpamkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bjuD (D:)
    msvdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkv
    agrihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnp
    gktkkgelsiipyeitllspclhmlphlhfglkdketryrqryldlilndfvrqkfiirs
    kiityirsfldelgfleietpmmniipggavakpfityhneldmnlymriapelyhkmlv
    vggidrvyeigrqfrnegidlthnpefttcefymayadyhdlmeitekmvsgmvkhitgs
    ykvtyhpdgpegqaydvdftppfrrinmveelekalgmklpetnlfeteetrkilddicv
    akavecppprttarlldklvgeflevtcinptficdhpqimsplakwhrskeglterfel
    fvmkkeicnaytelndpmrqrqlfeeqakakaagddeamfidenfctaleyglpptagwg
    mgidrvamfltdsnnikevllfpamkpedkkenlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bjuD (D:)
    vdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvag
    rihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgk
    tkkgelsiipyeitllspclhmlpkdketryrqryldlilndfvrqkfiirskiityirs
    fldelgfleietpmmniipggavakpfityhneldmnlymriapelyhkmlvvggidrvy
    eigrqfrnegidlthnpefttcefymayadyhdlmeitekmvsgmvkhitgsykvtyhpd
    gpegqaydvdftppfrrinmveelekalgmklpetnlfeteetrkilddicvakavecpp
    prttarlldklvgeflevtcinptficdhpqimsplakwhrskeglterfelfvmkkeic
    naytelndpmrqrqlfeeqakakaagddeamfidenfctaleyglpptagwgmgidrvam
    fltdsnnikevllfpamkp