SCOP 1.71: Domain d1zagc1: 1zag C:184-278

Lineage for d1zagc1 (1zag C:184-278)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species)
fat depleting factor related to class I MHC
Species Human (Homo sapiens) [TaxId:9606] [48966] (7 PDB entries)
Domain d1zagc1: 1zag C:184-278 [20853]
Other proteins in same PDB: d1zaga2, d1zagb2, d1zagc2, d1zagd2

Details for d1zagc1

PDB Entry: 1zag (more details), 2.8 Å

PDB Description: human zinc-alpha-2-glycoprotein

SCOP Domain Sequences for d1zagc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zagc1 b.1.1.2 (C:184-278) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens)}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpweas

SCOP Domain Coordinates for d1zagc1:

Click to download the PDB-style file with coordinates for d1zagc1.
(The format of our PDB-style files is described here.)

Timeline for d1zagc1: